Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries) |
Domain d2jifd1: 2jif D:52-279 [205055] Other proteins in same PDB: d2jifa2, d2jifb2, d2jifc2, d2jifd2 automated match to d1rx0a2 complexed with cl, cos, edo, fad |
PDB Entry: 2jif (more details), 2 Å
SCOPe Domain Sequences for d2jifd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jifd1 e.6.1.0 (D:52-279) automated matches {Human (Homo sapiens) [TaxId: 9606]} aplqtftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpey ggtgasflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekv gsfclseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykg itsflvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqi
Timeline for d2jifd1: