Lineage for d2jifd1 (2jif D:52-279)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015730Species Human (Homo sapiens) [TaxId:9606] [225242] (2 PDB entries)
  8. 3015734Domain d2jifd1: 2jif D:52-279 [205055]
    Other proteins in same PDB: d2jifa2, d2jifb2, d2jifc2, d2jifd2
    automated match to d1rx0a2
    complexed with cl, cos, edo, fad

Details for d2jifd1

PDB Entry: 2jif (more details), 2 Å

PDB Description: structure of human short-branched chain acyl-coa dehydrogenase (acadsb)
PDB Compounds: (D:) short/branched chain specific acyl-coa dehydrogenase

SCOPe Domain Sequences for d2jifd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jifd1 e.6.1.0 (D:52-279) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplqtftdeemmikssvkkfaqeqiaplvstmdenskmeksviqglfqqglmgievdpey
ggtgasflstvlvieelakvdasvavfceiqntlintlirkhgteeqkatylpqlttekv
gsfclseagagsdsfalktradkegdyyvlngskmwissaehaglflvmanvdptigykg
itsflvdrdtpglhigkpenklglrasstcpltfenvkvpeanilgqi

SCOPe Domain Coordinates for d2jifd1:

Click to download the PDB-style file with coordinates for d2jifd1.
(The format of our PDB-style files is described here.)

Timeline for d2jifd1: