Lineage for d2iwza1 (2iwz A:-4-296)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627619Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 1627622Domain d2iwza1: 2iwz A:-4-296 [204884]
    automated match to d1j3na1
    complexed with 6na, nh4

Details for d2iwza1

PDB Entry: 2iwz (more details), 1.65 Å

PDB Description: human mitochondrial beta-ketoacyl acp synthase complexed with hexanoic acid
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d2iwza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iwza1 c.95.1.0 (A:-4-296) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iegrsrlhrrvvitgiglvtplgvgthlvwdrliggesgivslvgeeyksipcsvaayvp
rgsdegqfneqnfvsksdiksmssptimaigaaelamkdsgwhpqseadqvatgvaigmg
miplevvsetalnfqtkgynkvspffvpkilvnmaagqvsiryklkgpnhavstacttga
havgdsfrfiahgdadvmvaggtdscisplslagfsraralstnsdpklacrpfhpkrdg
fvmgegaavlvleeyehavqrra

SCOPe Domain Coordinates for d2iwza1:

Click to download the PDB-style file with coordinates for d2iwza1.
(The format of our PDB-style files is described here.)

Timeline for d2iwza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iwza2