![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
![]() | Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
![]() | Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
![]() | Protein automated matches [226907] (12 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [225354] (3 PDB entries) |
![]() | Domain d2ijxb2: 2ijx B:127-244 [204799] automated match to d1ud9a2 complexed with edo |
PDB Entry: 2ijx (more details), 1.9 Å
SCOPe Domain Sequences for d2ijxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijxb2 d.131.1.0 (B:127-244) automated matches {Sulfolobus solfataricus [TaxId: 273057]} qfdisatissdgfksaisevstvtdnvvveghedrilikaegesevevefskdtgglqdl efskesknsysaeylddvlsltklsdyvkisfgnqkplqlffnmegggkvtyllapkv
Timeline for d2ijxb2: