Lineage for d2i8ca1 (2i8c A:3-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862479Species Staphylococcus aureus [TaxId:93062] [225143] (2 PDB entries)
  8. 2862482Domain d2i8ca1: 2i8c A:3-128 [204750]
    Other proteins in same PDB: d2i8ca2, d2i8ca3, d2i8cb2, d2i8cb3
    automated match to d1ehib1
    complexed with adp, mg, so4

Details for d2i8ca1

PDB Entry: 2i8c (more details), 2.46 Å

PDB Description: Allosteric inhibition of Staphylococcus aureus D-alanine:D-alanine ligase revealed by crystallographic studies
PDB Compounds: (A:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2i8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i8ca1 c.30.1.0 (A:3-128) automated matches {Staphylococcus aureus [TaxId: 93062]}
kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst
delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl
saassm

SCOPe Domain Coordinates for d2i8ca1:

Click to download the PDB-style file with coordinates for d2i8ca1.
(The format of our PDB-style files is described here.)

Timeline for d2i8ca1: