Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225145] (3 PDB entries) |
Domain d2i80a1: 2i80 A:3-128 [204737] Other proteins in same PDB: d2i80a2, d2i80a3, d2i80b2, d2i80b3 automated match to d1ehib1 complexed with g1l |
PDB Entry: 2i80 (more details), 2.19 Å
SCOPe Domain Sequences for d2i80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i80a1 c.30.1.0 (A:3-128) automated matches {Staphylococcus aureus [TaxId: 1280]} kenicivfggksaehevsiltaqnvlnaidkdkyhvdiiyitndgdwrkqnnitaeikst delhlengealeisqllkesssgqpydavfpllhgpngedgtiqglfevldvpyvgngvl saassm
Timeline for d2i80a1: