SCOPe 2.07: Domain d2hyyd1: 2hyy D:246-498

Lineage for d2hyyd1 (2hyy D:246-498)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)

8. Domain d2hyyd1: 2hyy D:246-498 [204665]
   Other proteins in same PDB: d2hyyb2, d2hyyc2, d2hyyd2
   automated match to d2e2ba_
   complexed with sti

Details for d2hyyd1

PDB Entry: 2hyy, 2.4 Å

PDB Description: human abl kinase domain in complex with imatinib (sti571, glivec)

PDB Compounds: (D:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hyyd1:

Sequence, based on SEQRES records:

>d2hyyd1 d.144.1.7 (D:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc
treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla
arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf
gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps
faeihqafetmfq

Sequence, based on observed residues (ATOM records):

>d2hyyd1 d.144.1.7 (D:246-498) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
hklgggqygevyegvwkkysltvavktlkemeveeflkeaavmkeikhpnlvqllgvctr
eppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaar
nclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgv
llweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfa
eihqafetmfq

Timeline for d2hyyd1:

• d2hyyd1 first appeared in SCOPe 2.03, called d2hyyd_
  
• d2hyyd1 appears in SCOPe 2.06
  
• d2hyyd1 appears in the current release, SCOPe 2.08