Lineage for d2hyyd_ (2hyy D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1433649Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 1433650Species Human (Homo sapiens) [TaxId:9606] [226825] (5 PDB entries)
  8. 1433659Domain d2hyyd_: 2hyy D: [204665]
    automated match to d2e2ba_
    complexed with sti

Details for d2hyyd_

PDB Entry: 2hyy (more details), 2.4 Å

PDB Description: human abl kinase domain in complex with imatinib (sti571, glivec)
PDB Compounds: (D:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hyyd_:

Sequence, based on SEQRES records: (download)

>d2hyyd_ d.144.1.7 (D:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke
ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissame
ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapesla
ynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelm
racwqwnpsdrpsfaeihqafetmfq

Sequence, based on observed residues (ATOM records): (download)

>d2hyyd_ d.144.1.7 (D:) Abelsone tyrosine kinase (abl) {Human (Homo sapiens) [TaxId: 9606]}
dkwemertditmkhklgggqygevyegvwkkysltvavktlkemeveeflkeaavmkeik
hpnlvqllgvctreppfyiitefmtygnlldylrecnrqevnavvllymatqissameyl
ekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslayn
kfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmra
cwqwnpsdrpsfaeihqafetmfq

SCOPe Domain Coordinates for d2hyyd_:

Click to download the PDB-style file with coordinates for d2hyyd_.
(The format of our PDB-style files is described here.)

Timeline for d2hyyd_: