Class a: All alpha proteins [46456] (284 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
Protein automated matches [226884] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries) |
Domain d2gl6c1: 2gl6 C:48-137 [204399] Other proteins in same PDB: d2gl6a2, d2gl6b2, d2gl6c2, d2gl6d2, d2gl6e2, d2gl6f2, d2gl6g2, d2gl6h2 automated match to d1crka1 complexed with adp, mg, unx |
PDB Entry: 2gl6 (more details), 2.3 Å
SCOPe Domain Sequences for d2gl6c1:
Sequence, based on SEQRES records: (download)
>d2gl6c1 a.83.1.0 (C:48-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} fppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfiktvg mvagdeesyevfadlfdpviklrhngydpr
>d2gl6c1 a.83.1.0 (C:48-137) automated matches {Human (Homo sapiens) [TaxId: 9606]} fppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnptvgmvagde esyevfadlfdpviklrhngydpr
Timeline for d2gl6c1: