SCOPe 2.03: Domain d2gl6b1: 2gl6 B:46-137

Lineage for d2gl6b1 (2gl6 B:46-137)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)

8. Domain d2gl6b1: 2gl6 B:46-137 [204397]
   Other proteins in same PDB: d2gl6a2, d2gl6b2, d2gl6c2, d2gl6d2, d2gl6e2, d2gl6f2, d2gl6g2, d2gl6h2
   automated match to d1crka1
   complexed with adp, mg, unx

Details for d2gl6b1

PDB Entry: 2gl6, 2.3 Å

PDB Description: crystal structure of human sarcomeric mitochondrial creatine kinase

PDB Compounds: (B:) creatine kinase

SCOPe Domain Sequences for d2gl6b1:

Sequence, based on SEQRES records:

>d2gl6b1 a.83.1.0 (B:46-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpghpfikt
vgmvagdeesyevfadlfdpviklrhngydpr

Sequence, based on observed residues (ATOM records):

>d2gl6b1 a.83.1.0 (B:46-137) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlfppsadypdlrkhnncmaecltpaiyaklrnkvtpngytldqciqtgvdnpktvgmva
gdeesyevfadlfdpviklrhngydpr

Timeline for d2gl6b1:

• d2gl6b1 is new in SCOPe 2.03-stable
  
• d2gl6b1 appears in SCOPe 2.04
  
• d2gl6b1 last appears in SCOPe 2.05