Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries) |
Domain d2gkga_: 2gkg A: [204390] automated match to d2iynb_ |
PDB Entry: 2gkg (more details), 1 Å
SCOPe Domain Sequences for d2gkga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkga_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 34]} kkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagqng ylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlveragaligf pe
Timeline for d2gkga_: