Lineage for d2gkga_ (2gkg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115288Species Myxococcus xanthus [TaxId:34] [225234] (4 PDB entries)
  8. 2115289Domain d2gkga_: 2gkg A: [204390]
    automated match to d2iynb_

Details for d2gkga_

PDB Entry: 2gkg (more details), 1 Å

PDB Description: Receiver domain from Myxococcus xanthus social motility protein FrzS
PDB Compounds: (A:) response regulator homolog

SCOPe Domain Sequences for d2gkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gkga_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 34]}
kkilivesdtalsatlrsalegrgftvdettdgkgsveqirrdrpdlvvlavdlsagqng
ylicgklkkdddlknvpiviignpdgfaqhrklkahadeyvakpvdadqlveragaligf
pe

SCOPe Domain Coordinates for d2gkga_:

Click to download the PDB-style file with coordinates for d2gkga_.
(The format of our PDB-style files is described here.)

Timeline for d2gkga_: