SCOPe 2.06: Domain d2evxa2: 2evx A:281-453

Lineage for d2evxa2 (2evx A:281-453)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (23 species)
   not a true protein

7. Species Pumpkin (Cucurbita maxima) [TaxId:3661] [225177] (2 PDB entries)

8. Domain d2evxa2: 2evx A:281-453 [204144]
   automated match to d1fxza2
   complexed with mg

Details for d2evxa2

PDB Entry: 2evx, 2.6 Å

PDB Description: Crystal structure of pumpkin seed globulin

PDB Compounds: (A:) 11S globulin beta subunit

SCOPe Domain Sequences for d2evxa2:

Sequence; same for both SEQRES and ATOM records:

>d2evxa2 b.82.1.0 (A:281-453) automated matches {Pumpkin (Cucurbita maxima) [TaxId: 3661]}
ictlrlkqnigrseradvfnprggristanyhtlpilrqvrlsaergvlysnamvaphyt
vnshsvmyatrgnarvqvvdnfgqsvfdgevregqvlmipqnfvvikrasdrgfewiafk
tndnaitnllagrvsqmrmlplgvlsnmyrisreeaqrlkygqqemrvlspgr

Timeline for d2evxa2:

• d2evxa2 first appeared in SCOPe 2.03
  
• d2evxa2 appears in SCOPe 2.05
  
• d2evxa2 appears in SCOPe 2.07
  
• d2evxa2 appears in the current release, SCOPe 2.08