SCOPe 2.05: Domain d2dplb1: 2dpl B:6-189

Lineage for d2dplb1 (2dpl B:6-189)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (18 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187637] (3 PDB entries)

8. Domain d2dplb1: 2dpl B:6-189 [204021]
   Other proteins in same PDB: d2dpla2, d2dplb2
   automated match to d1gpma1

Details for d2dplb1

PDB Entry: 2dpl, 1.43 Å

PDB Description: Crystal Structure of the GMP synthase from Pyrococcus horikoshii OT3

PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing] subunit B

SCOPe Domain Sequences for d2dplb1:

Sequence, based on SEQRES records:

>d2dplb1 c.26.2.0 (B:6-189) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
fveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrkgepef
vvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkigaeyli
qgtiapdwiesqgkikshhnvgglpeklnlklieplrdlykdevrelakflglpekiynr
mpfp

Sequence, based on observed residues (ATOM records):

>d2dplb1 c.26.2.0 (B:6-189) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
fveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrkgepef
vvktfrdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkigaeyli
qgtilklieplrdlykdevrelakflglpekiynrmpfp

Timeline for d2dplb1:

• d2dplb1 first appeared in SCOPe 2.03
  
• d2dplb1 appears in SCOPe 2.04
  
• d2dplb1 appears in SCOPe 2.06
  
• d2dplb1 appears in the current release, SCOPe 2.08