Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.44: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82693] (1 family) duplication: the N- and C-terminal halves of the whole proteins are structurally similar; each half contains two domains of this fold |
Family d.58.44.1: Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82694] (1 protein) |
Protein Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains [82695] (1 species) PN2 and PC2 subdomains are interrupted by the inserted subdomains DN and DC, respectively |
Species Escherichia coli [TaxId:562] [82696] (7 PDB entries) |
Domain d2dhhc7: 2dhh C:674-724,C:813-859 [204015] Other proteins in same PDB: d2dhha1, d2dhha4, d2dhha5, d2dhha8, d2dhhb1, d2dhhb4, d2dhhb5, d2dhhb8, d2dhhc1, d2dhhc4, d2dhhc5, d2dhhc8 automated match to d1iwga4 |
PDB Entry: 2dhh (more details), 2.8 Å
SCOPe Domain Sequences for d2dhhc7:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dhhc7 d.58.44.1 (C:674-724,C:813-859) Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains {Escherichia coli [TaxId: 562]} lgtatgfdfelidqaglghekltqarnqllaeaakhpdmltsvrpngledtXsprleryn glpsmeilgqaapgkstgeamelmeqlasklptgvgydw
Timeline for d2dhhc7: