Lineage for d2dhhb5 (2dhh B:513-566,B:869-1036)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458321Fold f.35: Multidrug efflux transporter AcrB transmembrane domain [82865] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves of the whole proteins are structurally similar
  4. 1458322Superfamily f.35.1: Multidrug efflux transporter AcrB transmembrane domain [82866] (1 family) (S)
  5. 1458323Family f.35.1.1: Multidrug efflux transporter AcrB transmembrane domain [82867] (1 protein)
  6. 1458324Protein Multidrug efflux transporter AcrB transmembrane domain [82868] (1 species)
  7. 1458325Species Escherichia coli [TaxId:562] [82869] (7 PDB entries)
  8. 1458333Domain d2dhhb5: 2dhh B:513-566,B:869-1036 [204005]
    Other proteins in same PDB: d2dhha2, d2dhha3, d2dhha4, d2dhha6, d2dhha7, d2dhha8, d2dhhb2, d2dhhb3, d2dhhb4, d2dhhb6, d2dhhb7, d2dhhb8, d2dhhc2, d2dhhc3, d2dhhc4, d2dhhc6, d2dhhc7, d2dhhc8
    automated match to d1iwga8

Details for d2dhhb5

PDB Entry: 2dhh (more details), 2.8 Å

PDB Description: Crystal structure of a multidrug transporter reveal a functionally rotating mechanism
PDB Compounds: (B:) AcrB

SCOPe Domain Sequences for d2dhhb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dhhb5 f.35.1.1 (B:513-566,B:869-1036) Multidrug efflux transporter AcrB transmembrane domain {Escherichia coli [TaxId: 562]}
fgwfnrmfeksthhytdsvggilrstgrylvlyliivvgmaylfvrlpssflpdXsgnqa
pslyaislivvflclaalyeswsipfsvmlvvplgvigallaatfrgltndvyfqvgllt
tiglsaknailivefakdlmdkegkglieatldavrmrlrpilmtslafilgvmplvist
gagsgaqnavgtgvmggmvtatvlaiffvpvffvvvrrrfsrk

SCOPe Domain Coordinates for d2dhhb5:

Click to download the PDB-style file with coordinates for d2dhhb5.
(The format of our PDB-style files is described here.)

Timeline for d2dhhb5: