Lineage for d2dfdc2 (2dfd C:151-319)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1938736Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1939065Protein automated matches [226882] (7 species)
    not a true protein
  7. 1939092Species Human (Homo sapiens) [TaxId:9606] [225057] (2 PDB entries)
  8. 1939095Domain d2dfdc2: 2dfd C:151-319 [203982]
    Other proteins in same PDB: d2dfda1, d2dfdb1, d2dfdc1, d2dfdd1
    automated match to d1mlda2
    complexed with ala, cl, his, mlt, nad

Details for d2dfdc2

PDB Entry: 2dfd (more details), 1.9 Å

PDB Description: Crystal Structure of Human Malate Dehydrogenase Type 2
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d2dfdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfdc2 d.162.1.1 (C:151-319) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

SCOPe Domain Coordinates for d2dfdc2:

Click to download the PDB-style file with coordinates for d2dfdc2.
(The format of our PDB-style files is described here.)

Timeline for d2dfdc2: