Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225057] (2 PDB entries) |
Domain d2dfdc2: 2dfd C:151-319 [203982] Other proteins in same PDB: d2dfda1, d2dfdb1, d2dfdc1, d2dfdd1 automated match to d1mlda2 complexed with ala, cl, his, mlt, nad |
PDB Entry: 2dfd (more details), 1.9 Å
SCOPe Domain Sequences for d2dfdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dfdc2 d.162.1.1 (C:151-319) automated matches {Human (Homo sapiens) [TaxId: 9606]} vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl
Timeline for d2dfdc2: