SCOPe 2.08: Domain d2c7za2: 2c7z A:312-441

Lineage for d2c7za2 (2c7z A:312-441)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225073] (3 PDB entries)

8. Domain d2c7za2: 2c7z A:312-441 [203750]
   automated match to d1afwa2

Details for d2c7za2

PDB Entry: 2c7z, 2.37 Å

PDB Description: plant enzyme crystal form ii

PDB Compounds: (A:) 3-ketoacyl-coa thiolase 2

SCOPe Domain Sequences for d2c7za2:

Sequence; same for both SEQRES and ATOM records:

>d2c7za2 c.95.1.0 (A:312-441) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kglpvlgvfrtfaavgvdpaimgigpavaipaavkaaglelddidlfeineafasqfvyc
rnklgldpekinvnggamaighplgatgarcvatllhemkrrgkdcrfgvvsmcigtgmg
aaavfergdg

Timeline for d2c7za2:

• d2c7za2 first appeared in SCOPe 2.03
  
• d2c7za2 appears in SCOPe 2.07