Lineage for d2b5ob2 (2b5o B:243-402)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359066Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1359067Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1359225Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1359226Protein automated matches [226871] (12 species)
    not a true protein
  7. 1359283Species Synechococcus sp. [TaxId:32049] [225028] (1 PDB entry)
  8. 1359285Domain d2b5ob2: 2b5o B:243-402 [203560]
    Other proteins in same PDB: d2b5oa1, d2b5ob1
    automated match to d1frna2
    complexed with fad, so4

Details for d2b5ob2

PDB Entry: 2b5o (more details), 2.5 Å

PDB Description: ferredoxin-nadp reductase
PDB Compounds: (B:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d2b5ob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ob2 c.25.1.0 (B:243-402) automated matches {Synechococcus sp. [TaxId: 32049]}
mllpddedatvvmlatgtgiapfraflwrmfkeqhedykfkgkawlifgvpytanilykd
dfekmaaenpdnfrltyaisreqktadggkvyvqsrvseyadelfemiqkpnthvymcgl
kgmqppidetftaeaekrglnweemrrsmkkehrwhvevy

SCOPe Domain Coordinates for d2b5ob2:

Click to download the PDB-style file with coordinates for d2b5ob2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2b5ob1