Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [224980] (2 PDB entries) |
Domain d1zl9a2: 1zl9 A:80-207 [203341] Other proteins in same PDB: d1zl9a1, d1zl9b1 automated match to d1tw9a1 complexed with gsh |
PDB Entry: 1zl9 (more details), 2.01 Å
SCOPe Domain Sequences for d1zl9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zl9a2 a.45.1.0 (A:80-207) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} ngktaweeaqvnsladqykdyssearpyfyavmgfgpgdvetlkkdiflpafekfygflv nflkasgsgflvgdsltwidlaiaqhsadliakggdfskfpelkahaekiqaipqikkwi etrpvtpf
Timeline for d1zl9a2: