SCOP 1.57: Domain d1blna1: 1bln A:1-107

Lineage for d1blna1 (1bln A:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [48871] (1 PDB entry)

8. Domain d1blna1: 1bln A:1-107 [20330]
   Other proteins in same PDB: d1blna2, d1blnb2, d1blnc2, d1blnd2

Details for d1blna1

PDB Entry: 1bln, 2.8 Å

PDB Description: anti-p-glycoprotein fab mrk-16

SCOP Domain Sequences for d1blna1:

Sequence; same for both SEQRES and ATOM records:

>d1blna1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
dvlmtqtpvslsvslgdqasiscrssqsivhstgntylewylqkpgqspklliykisnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashaprtfgggtkleik

Timeline for d1blna1:

• d1blna1 first appeared (with stable ids) in SCOP 1.55
  
• d1blna1 appears in SCOP 1.59
  
• d1blna1 appears in the current release, SCOPe 2.08