Lineage for d1blna1 (1bln A:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102136Species Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain [48871] (1 PDB entry)
  8. 102137Domain d1blna1: 1bln A:1-107 [20330]
    Other proteins in same PDB: d1blna2, d1blnb2, d1blnc2, d1blnd2

Details for d1blna1

PDB Entry: 1bln (more details), 2.8 Å

PDB Description: anti-p-glycoprotein fab mrk-16

SCOP Domain Sequences for d1blna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blna1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-p-glycoprotein Fab MRK-16 (mouse), kappa L chain}
dvlmtqtpvslsvslgdqasiscrssqsivhstgntylewylqkpgqspklliykisnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqashaprtfgggtkleik

SCOP Domain Coordinates for d1blna1:

Click to download the PDB-style file with coordinates for d1blna1.
(The format of our PDB-style files is described here.)

Timeline for d1blna1: