Lineage for d1z03f1 (1z03 F:16-163)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309738Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 1309739Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [141178] (1 species)
  7. 1309740Species Pseudomonas putida [TaxId:303] [141179] (3 PDB entries)
    Uniprot O05935 16-163
  8. 1309752Domain d1z03f1: 1z03 F:16-163 [203266]
    Other proteins in same PDB: d1z03a2, d1z03b2, d1z03c2, d1z03d2, d1z03e2, d1z03f2
    automated match to d1z01a1
    complexed with fe, fes, och

Details for d1z03f1

PDB Entry: 1z03 (more details), 1.8 Å

PDB Description: 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction
PDB Compounds: (F:) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component

SCOPe Domain Sequences for d1z03f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z03f1 b.33.1.2 (F:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
isdarannaktqsqyqpykdaawgfinhwypalftheleedqvqgiqicgvpivlrrvng
kvfalkdqclhrgvrlsekptcftkstiscwyhgftfdletgklvtivanpedkligttg
vttypvhevngmifvfvreddfpdedvp

SCOPe Domain Coordinates for d1z03f1:

Click to download the PDB-style file with coordinates for d1z03f1.
(The format of our PDB-style files is described here.)

Timeline for d1z03f1: