Lineage for d1z03c2 (1z03 C:164-442)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431332Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1431333Protein 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO [143823] (1 species)
  7. 1431334Species Pseudomonas putida [TaxId:303] [143824] (3 PDB entries)
    Uniprot O05935 164-442
  8. 1431343Domain d1z03c2: 1z03 C:164-442 [203261]
    Other proteins in same PDB: d1z03a1, d1z03b1, d1z03c1, d1z03d1, d1z03e1, d1z03f1
    automated match to d1z01a2
    complexed with fe, fes, och

Details for d1z03c2

PDB Entry: 1z03 (more details), 1.8 Å

PDB Description: 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction
PDB Compounds: (C:) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component

SCOPe Domain Sequences for d1z03c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z03c2 d.129.3.3 (C:164-442) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]}
plahdlpfrfperseqfphplwpsspsvlddnavvhgmhrtgfgnwriacengfdnahil
vhkdntivhamdwvlplgllptsddciavvedddgpkgmmqwlftdkwapvlenqelglk
veglkgrhyrtsvvlpgvlmvenwpeehvvqyewyvpitddtheyweilvrvcptdedrk
kfqyrydhmykplclhgfndsdlyareamqnfyydgtgwddeqlvatdispitwrklasr
wnrgiakpgrgvagavkdtslifkqtadgkrpgykveqi

SCOPe Domain Coordinates for d1z03c2:

Click to download the PDB-style file with coordinates for d1z03c2.
(The format of our PDB-style files is described here.)

Timeline for d1z03c2: