Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (30 species) not a true protein |
Species Bacillus halodurans [TaxId:272558] [225042] (2 PDB entries) |
Domain d1ynpb1: 1ynp B:1-297 [203209] Other proteins in same PDB: d1ynpa2, d1ynpb2 automated match to d4asth_ complexed with gol, na, so4, suc |
PDB Entry: 1ynp (more details), 1.25 Å
SCOPe Domain Sequences for d1ynpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynpb1 c.1.7.0 (B:1-297) automated matches {Bacillus halodurans [TaxId: 272558]} mkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqfv gkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikeavkdslrrlqtdyidlyqlhg gtiddpidetieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrpe ewfpliqehgvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhela lqyclahdvvatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre
Timeline for d1ynpb1: