SCOPe 2.08: Domain d1ynpb1: 1ynp B:1-297

Lineage for d1ynpb1 (1ynp B:1-297)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (31 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [225042] (2 PDB entries)

8. Domain d1ynpb1: 1ynp B:1-297 [203209]
   Other proteins in same PDB: d1ynpa2, d1ynpb2
   automated match to d4asth_
   complexed with gol, na, so4

Details for d1ynpb1

PDB Entry: 1ynp, 1.25 Å

PDB Description: aldo-keto reductase akr11c1 from bacillus halodurans (apo form)

PDB Compounds: (B:) Oxidoreductase

SCOPe Domain Sequences for d1ynpb1:

Sequence; same for both SEQRES and ATOM records:

>d1ynpb1 c.1.7.0 (B:1-297) automated matches {Bacillus halodurans [TaxId: 272558]}
mkkrqlgtsdlhvselgfgcmslgtdetkarrimdevlelginyldtadlynqglneqfv
gkalkgrrqdiilatkvgnrfeqgkegwwwdpskayikeavkdslrrlqtdyidlyqlhg
gtiddpidetieafeelkqegviryygissirpnvikeylkrsnivsimmqysildrrpe
ewfpliqehgvsvvvrgpvargllsrrplpegegylnyrydelkllreslptdrplhela
lqyclahdvvatvaagassidqvkanvqaveatpltaeerqhiqklakaavyeqhre

Timeline for d1ynpb1:

• d1ynpb1 first appeared in SCOPe 2.03, called d1ynpb_
  
• d1ynpb1 appears in SCOPe 2.07