SCOPe 2.08: Domain d1wl4a1: 1wl4 A:4-271

Lineage for d1wl4a1 (1wl4 A:4-271)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)

8. Domain d1wl4a1: 1wl4 A:4-271 [203001]
   automated match to d1afwa1
   complexed with coa, gol, so4

Details for d1wl4a1

PDB Entry: 1wl4, 1.55 Å

PDB Description: Human cytosolic acetoacetyl-CoA thiolase complexed with CoA

PDB Compounds: (A:) acetyl-Coenzyme A acetyltransferase 2

SCOPe Domain Sequences for d1wl4a1:

Sequence; same for both SEQRES and ATOM records:

>d1wl4a1 c.95.1.0 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsdpvvivsaartiigsfngalaavpvqdlgstvikevlkratvapedvsevifghvlaa
gcgqnpvrqasvgagipysvpawscqmicgsglkavclavqsigigdssivvaggmenms
kaphlaylrtgvkigempltdsilcdgltdafhnchmgitaenvakkwqvsredqdkvav
lsqnrtenaqkaghfdkeivpvlvstrkglievktdefprhgsnieamsklkpyfltdgt
gtvtpanasgindgaaavvlmkkseadk

Timeline for d1wl4a1:

• d1wl4a1 first appeared in SCOPe 2.03
  
• d1wl4a1 appears in SCOPe 2.07