Lineage for d1seql2 (1seq L:107-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763668Domain d1seql2: 1seq L:107-211 [202885]
    Other proteins in same PDB: d1seql1
    automated match to d1dqdl2
    complexed with ipa, so4, trs

Details for d1seql2

PDB Entry: 1seq (more details), 1.78 Å

PDB Description: fab mnac13
PDB Compounds: (L:) Monoclonal Antibody MNAC13

SCOPe Domain Sequences for d1seql2:

Sequence, based on SEQRES records: (download)

>d1seql2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypksinskwkidgserqngvlnswtdqd
skdstysmsstltltkneyerhnsytceathktstspivksfnrs

Sequence, based on observed residues (ATOM records): (download)

>d1seql2 b.1.1.2 (L:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypksinskwkidgserqngvlnswtdqd
skdstysmsstltltkneyerhnsytceathkspivksfnrs

SCOPe Domain Coordinates for d1seql2:

Click to download the PDB-style file with coordinates for d1seql2.
(The format of our PDB-style files is described here.)

Timeline for d1seql2: