Lineage for d4kgnh_ (4kgn H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921451Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries)
  8. 2921457Domain d4kgnh_: 4kgn H: [202850]
    Other proteins in same PDB: d4kgnc2, d4kgnd2, d4kgnf2
    automated match to d3e5ya_
    complexed with cl, sah

Details for d4kgnh_

PDB Entry: 4kgn (more details), 2.15 Å

PDB Description: Crystal structure of a tRNA (cytidine(34)-2'-O)-methyltransferase bound to S-adenosyl homocysteine
PDB Compounds: (H:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4kgnh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kgnh_ c.116.1.0 (H:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
mfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmrvh
rdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeq
rvrlpmrpgnrslnlsntvavvvfeawrqagfegga

SCOPe Domain Coordinates for d4kgnh_:

Click to download the PDB-style file with coordinates for d4kgnh_.
(The format of our PDB-style files is described here.)

Timeline for d4kgnh_: