![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries) |
![]() | Domain d1gc1h1: 1gc1 H:1-129 [20265] Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h2, d1gc1l2 |
PDB Entry: 1gc1 (more details), 2.5 Å
SCOP Domain Sequences for d1gc1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc1h1 b.1.1.1 (H:1-129) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq gtlvtvtsa
Timeline for d1gc1h1: