SCOP 1.55: Domain d1gc1h1: 1gc1 H:1-129

Lineage for d1gc1h1 (1gc1 H:1-129)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species HIV-1 neutralizing Fab 17B (human), kappa L chain [48854] (3 PDB entries)
Domain d1gc1h1: 1gc1 H:1-129 [20265]
Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h2, d1gc1l2

Details for d1gc1h1

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1h1 b.1.1.1 (H:1-129) Immunoglobulin (variable domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
qvqllesgaevkkpgssvkvsckasgdtfirysftwvrqapgqglewmgriitildvahy
aphlqgrvtitadkststvylelrnlrsddtavyfcagvyegeadegeydnngflkhwgq
gtlvtvtsa

SCOP Domain Coordinates for d1gc1h1:

Click to download the PDB-style file with coordinates for d1gc1h1.
(The format of our PDB-style files is described here.)

Timeline for d1gc1h1: