SCOP 1.55: Domain d1gc1l2: 1gc1 L:110-213

Lineage for d1gc1l2 (1gc1 L:110-213)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)

8. Domain d1gc1l2: 1gc1 L:110-213 [21264]
   Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1l1

Details for d1gc1l2

PDB Entry: 1gc1, 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1l2:

Sequence; same for both SEQRES and ATOM records:

>d1gc1l2 b.1.1.2 (L:110-213) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1gc1l2:

• d1gc1l2 appears in SCOP 1.57
  
• d1gc1l2 appears in the current release, SCOPe 2.08