Lineage for d4ihjc2 (4ihj C:246-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201530Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)
  8. 2201533Domain d4ihjc2: 4ihj C:246-440 [202615]
    Other proteins in same PDB: d4ihja1, d4ihjb1, d4ihjc1, d4ihjd1, d4ihje_, d4ihjf1, d4ihjf2, d4ihjf3
    automated match to d1tuba2
    complexed with adp, ca, cl, gdp, gol, gtp, mes, mg

Details for d4ihjc2

PDB Entry: 4ihj (more details), 2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl-adp complex
PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d4ihjc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ihjc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d4ihjc2:

Click to download the PDB-style file with coordinates for d4ihjc2.
(The format of our PDB-style files is described here.)

Timeline for d4ihjc2: