Lineage for d4i8ad_ (4i8a D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147545Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2147765Protein automated matches [190399] (9 species)
    not a true protein
  7. 2147782Species Human (Homo sapiens) [TaxId:9606] [189951] (14 PDB entries)
  8. 2147810Domain d4i8ad_: 4i8a D: [202595]
    automated match to d4i8aa_
    complexed with gol

Details for d4i8ad_

PDB Entry: 4i8a (more details), 2.9 Å

PDB Description: Alanine-glyoxylate aminotransferase variant S187F
PDB Compounds: (D:) Serine-pyruvate aminotransferase

SCOPe Domain Sequences for d4i8ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i8ad_ c.67.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegi
qyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarvh
pmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvds
vaflggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyldi
kwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqa
lglqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigll
gcnatrenvdrvtealraalqhcpkk

SCOPe Domain Coordinates for d4i8ad_:

Click to download the PDB-style file with coordinates for d4i8ad_.
(The format of our PDB-style files is described here.)

Timeline for d4i8ad_: