Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (44 species) not a true protein |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries) |
Domain d4hrtd1: 4hrt D:3-151 [202462] Other proteins in same PDB: d4hrta1, d4hrta2, d4hrtb2, d4hrtc1, d4hrtc2, d4hrtd2, d4hrte1, d4hrte2, d4hrtf2, d4hrtg1, d4hrtg2, d4hrth2 automated match to d4hrtb_ complexed with hem, po4 |
PDB Entry: 4hrt (more details), 1.46 Å
SCOPe Domain Sequences for d4hrtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hrtd1 a.1.1.2 (D:3-151) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} vaelanavvsnadqkdllrmswgvlsvdmegtglmlmanlfktspsakgkfarlgdvsag kdnsklrghsitlmyalqnfvdalddverlkcvvekfavnhinrqisadefgeivgplrq tlkarmgnyfdedtvaawaslvavvqaal
Timeline for d4hrtd1: