Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin I [46464] (2 species) |
Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) |
Domain d4hrtc1: 4hrt C:4-149 [192914] Other proteins in same PDB: d4hrta2, d4hrtb1, d4hrtb2, d4hrtc2, d4hrtd1, d4hrtd2, d4hrte2, d4hrtf1, d4hrtf2, d4hrtg2, d4hrth1, d4hrth2 automated match to d1scta_ complexed with hem, po4 |
PDB Entry: 4hrt (more details), 1.46 Å
SCOPe Domain Sequences for d4hrtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hrtc1 a.1.1.2 (C:4-149) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]} avakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkgkan sklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmketlk armgnyysddvagawaalvgvvqaal
Timeline for d4hrtc1: