Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries) |
Domain d1c1eh1: 1c1e H:1-119 [20239] Other proteins in same PDB: d1c1eh2, d1c1el1, d1c1el2 part of Diels-Alder catalytic Fab 1E9 complexed with dmr, enh |
PDB Entry: 1c1e (more details), 1.9 Å
SCOP Domain Sequences for d1c1eh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1eh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4} qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa kttpp
Timeline for d1c1eh1: