SCOPe 2.08: Domain d1c1eh1: 1c1e H:1-119

Lineage for d1c1eh1 (1c1e H:1-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1c1eh1: 1c1e H:1-119 [20239]
   Other proteins in same PDB: d1c1eh2, d1c1el1, d1c1el2
   part of Diels-Alder catalytic Fab 1E9
   complexed with enh, mlt

Details for d1c1eh1

PDB Entry: 1c1e, 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten

PDB Compounds: (H:) catalytic antibody 1e9 (heavy chain)

SCOPe Domain Sequences for d1c1eh1:

Sequence; same for both SEQRES and ATOM records:

>d1c1eh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf
addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa
kttpp

Timeline for d1c1eh1:

• d1c1eh1 first appeared (with stable ids) in SCOP 1.55
  
• d1c1eh1 appears in SCOPe 2.07