Lineage for d1ahwb1 (1ahw B:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102097Species Anti-human tissue factor Fab 5G9 (mouse), kappa L chain [48843] (2 PDB entries)
  8. 102101Domain d1ahwb1: 1ahw B:1-117 [20219]
    Other proteins in same PDB: d1ahwa2, d1ahwb2, d1ahwc1, d1ahwc2, d1ahwd2, d1ahwe2, d1ahwf1, d1ahwf2

Details for d1ahwb1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab 5G9 (mouse), kappa L chain}
eiqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqglewiglidpengntiy
dpkfqgkasitadtssntaylqlssltsedtavyycardnsyyfdywgqgttltvss

SCOP Domain Coordinates for d1ahwb1:

Click to download the PDB-style file with coordinates for d1ahwb1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwb1: