Lineage for d1ahwc1 (1ahw C:4-106)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105281Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 105282Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 105297Domain d1ahwc1: 1ahw C:4-106 [21963]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwc1:

Sequence, based on SEQRES records: (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

SCOP Domain Coordinates for d1ahwc1:

Click to download the PDB-style file with coordinates for d1ahwc1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwc1: