![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries) |
![]() | Domain d1ar1d_: 1ar1 D: [20206] Other proteins in same PDB: d1ar1a1, d1ar1b1, d1ar1b2 |
PDB Entry: 1ar1 (more details), 2.7 Å
SCOP Domain Sequences for d1ar1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar1d_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain} dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik
Timeline for d1ar1d_:
![]() Domains from other chains: (mouse over for more information) d1ar1a1, d1ar1b1, d1ar1b2, d1ar1c_ |