SCOP 1.55: Domain d1ar1d_: 1ar1 D:

Lineage for d1ar1d_ (1ar1 D:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain [48840] (2 PDB entries)

8. Domain d1ar1d_: 1ar1 D: [20206]
   Other proteins in same PDB: d1ar1a1, d1ar1b1, d1ar1b2

Details for d1ar1d_

PDB Entry: 1ar1, 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1d_:

Sequence; same for both SEQRES and ATOM records:

>d1ar1d_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Fv against Paracoccus denitrificans cytochrome c oxidase (mouse), kappa L chain}
dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleik

Timeline for d1ar1d_:

• d1ar1d_ appears in SCOP 1.57
  
• d1ar1d_ appears in the current release, SCOPe 2.08