Lineage for d1ar1b2 (1ar1 B:1-107)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38965Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins)
  6. 38966Protein Cytochrome c oxidase [56884] (3 species)
  7. 39068Species Paracoccus denitrificans [TaxId:266] [56886] (2 PDB entries)
  8. 39070Domain d1ar1b2: 1ar1 B:1-107 [43619]
    Other proteins in same PDB: d1ar1b1, d1ar1c_, d1ar1d_

Details for d1ar1b2

PDB Entry: 1ar1 (more details), 2.7 Å

PDB Description: Structure at 2.7 Angstrom Resolution of the Paracoccus Denitrificans two-subunit Cytochrome C Oxidase Complexed with an Antibody Fv Fragment

SCOP Domain Sequences for d1ar1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ar1b2 f.2.1.3 (B:1-107) Cytochrome c oxidase {Paracoccus denitrificans}
qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfvlyiitavtifvcllllicivrf
nrranpvparfthntpieviwtlvpvlilvaigafslpilfrsqemp

SCOP Domain Coordinates for d1ar1b2:

Click to download the PDB-style file with coordinates for d1ar1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ar1b2: