Lineage for d1axsh1 (1axs H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 103069Species Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains) [48839] (4 PDB entries)
  8. 103076Domain d1axsh1: 1axs H:1-113 [20199]
    Other proteins in same PDB: d1axsa2, d1axsb2, d1axsh2, d1axsl2

Details for d1axsh1

PDB Entry: 1axs (more details), 2.6 Å

PDB Description: mature oxy-cope catalytic antibody with hapten

SCOP Domain Sequences for d1axsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axsh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Oxy-cope catalytic Fab az-28, chimeric (mouse V domains/human C1 domains)}
qvqllesgaelmkpgasvkisckatgytfssfwiewvkqrpghglewigeilpgsggthy
nekfkgkatftadkssntaymqlssltsedsavyycarghsyyfydgdywgqgtsvtvss

SCOP Domain Coordinates for d1axsh1:

Click to download the PDB-style file with coordinates for d1axsh1.
(The format of our PDB-style files is described here.)

Timeline for d1axsh1: