Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein) |
Protein alpha-subunit of urease, catalytic domain [51561] (4 species) |
Species Enterobacter aerogenes [TaxId:548] [224877] (4 PDB entries) |
Domain d4epbc2: 4epb C:1130-1422,C:1476-1567 [201937] Other proteins in same PDB: d4epba_, d4epbb_, d4epbc1 automated match to d1ef2a2 complexed with ni |
PDB Entry: 4epb (more details), 1.75 Å
SCOPe Domain Sequences for d4epbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4epbc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Enterobacter aerogenes [TaxId: 548]} gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty evrvdgelitsepadvlpmaqryflf
Timeline for d4epbc2: