Lineage for d4em8a1 (4em8 A:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529227Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2529228Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2529280Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 2529281Protein automated matches [191196] (11 species)
    not a true protein
  7. 2529282Species Anaplasma phagocytophilum [TaxId:212042] [195541] (1 PDB entry)
  8. 2529283Domain d4em8a1: 4em8 A:2-143 [201861]
    Other proteins in same PDB: d4em8a2, d4em8b2
    automated match to d4em8b_

Details for d4em8a1

PDB Entry: 4em8 (more details), 1.95 Å

PDB Description: The Structure of Ribose 5-phosphate Isomerase B from Anaplasma phagocytophilum
PDB Compounds: (A:) Ribose 5-phosphate isomerase B

SCOPe Domain Sequences for d4em8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4em8a1 c.121.1.0 (A:2-143) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
vkrvflssdhagvelrlflsaylrdlgcevfdcgcdpkehsvdypdyvhdvvrevsdtsf
gvlicgtgigmsiaanrhkniraalcsstmlaklsrehndanvlcfgsryidpdtaqsvl
ytfmttaflggrhavrvqklge

SCOPe Domain Coordinates for d4em8a1:

Click to download the PDB-style file with coordinates for d4em8a1.
(The format of our PDB-style files is described here.)

Timeline for d4em8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4em8a2