![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
![]() | Protein automated matches [191196] (11 species) not a true protein |
![]() | Species Anaplasma phagocytophilum [TaxId:212042] [195541] (1 PDB entry) |
![]() | Domain d4em8a1: 4em8 A:2-143 [201861] Other proteins in same PDB: d4em8a2, d4em8b2 automated match to d4em8b_ |
PDB Entry: 4em8 (more details), 1.95 Å
SCOPe Domain Sequences for d4em8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4em8a1 c.121.1.0 (A:2-143) automated matches {Anaplasma phagocytophilum [TaxId: 212042]} vkrvflssdhagvelrlflsaylrdlgcevfdcgcdpkehsvdypdyvhdvvrevsdtsf gvlicgtgigmsiaanrhkniraalcsstmlaklsrehndanvlcfgsryidpdtaqsvl ytfmttaflggrhavrvqklge
Timeline for d4em8a1: