Lineage for d4eejb_ (4eej B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800547Protein automated matches [190295] (6 species)
    not a true protein
  7. 1800563Species Human (Homo sapiens) [TaxId:9606] [187133] (24 PDB entries)
  8. 1800579Domain d4eejb_: 4eej B: [201833]
    automated match to d4eeja_
    complexed with act, ret; mutant

Details for d4eejb_

PDB Entry: 4eej (more details), 1.5 Å

PDB Description: crystal structure of the q108k:k40l:t51v:t53c:y19w:r58w:t29l:q4r mutant of cellular retinol binding protein type ii in complex with all-trans-retinal at 1.5 angstrom resolution
PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d4eejb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eejb_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdrngtwemesnenfegwmkaldidfalrkiavrltqtlvidqdgdnfkvkctstfwny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d4eejb_:

Click to download the PDB-style file with coordinates for d4eejb_.
(The format of our PDB-style files is described here.)

Timeline for d4eejb_: