SCOPe 2.05: Domain d4di0a_: 4di0 A:

Lineage for d4di0a_ (4di0 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [196065] (1 PDB entry)

8. Domain d4di0a_: 4di0 A: [201710]
   automated match to d4di0b_
   complexed with edo, fe, gol

Details for d4di0a_

PDB Entry: 4di0, 1.9 Å

PDB Description: The structure of Rubrerythrin from Burkholderia pseudomallei

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d4di0a_:

Sequence; same for both SEQRES and ATOM records:

>d4di0a_ a.25.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aqlkgskteenlkyafagesqanrrylyfaskadvegqndiaalfrstaegetghahghl
eyleavgdpatglpfgtsrqnlqsaiagetheytdmypgmaktardegfeeianwfetla
kaershanrytkaldglvd

Timeline for d4di0a_:

• d4di0a_ first appeared in SCOPe 2.03
  
• d4di0a_ appears in SCOPe 2.04
  
• d4di0a_ appears in SCOPe 2.06
  
• d4di0a_ appears in the current release, SCOPe 2.08