Lineage for d1cfvh_ (1cfv H:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species Fv 4155 (mouse), kappa L chain [48832] (3 PDB entries) 
Domain d1cfvh_: 1cfv H: [20161]
Details for d1cfvh_
PDB Entry: 1cfv (more details), 2.1 Å
PDB Description: monoclonal antibody fragment fv4155 from e. coli
SCOP Domain Sequences for d1cfvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cfvh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fv 4155 (mouse), kappa L chain}
qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
SCOP Domain Coordinates for d1cfvh_:
Click to download the PDB-style file with coordinates for d1cfvh_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cfvh_:
- d1cfvh_ first appeared (with stable ids) in SCOP 1.55
- d1cfvh_ appears in SCOP 1.59
- d1cfvh_ appears in SCOP 1.63
- d1cfvh_ appears in the current release, SCOPe 2.08, called d1cfvh1
View in 3D
