Lineage for d4b0ma_ (4b0m A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1815074Fold b.167: FimD N-terminal domain-like [141728] (1 superfamily)
    pseudo barrel, capped by an alpha-helix; some topological similarity to the PRC-barrel domain (50346) and the N-terminal domain of Glutamine synthetase (54368)
  4. 1815075Superfamily b.167.1: FimD N-terminal domain-like [141729] (2 families) (S)
    automatically mapped to Pfam PF13954
  5. 1815083Family b.167.1.0: automated matches [227281] (1 protein)
    not a true family
  6. 1815084Protein automated matches [227092] (1 species)
    not a true protein
  7. 1815085Species Yersinia pestis [TaxId:632] [226478] (2 PDB entries)
  8. 1815086Domain d4b0ma_: 4b0m A: [201549]
    Other proteins in same PDB: d4b0mb_, d4b0mm1, d4b0mm2
    automated match to d1zdva1

Details for d4b0ma_

PDB Entry: 4b0m (more details), 1.8 Å

PDB Description: complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis
PDB Compounds: (A:) F1 capsule-anchoring protein

SCOPe Domain Sequences for d4b0ma_:

Sequence, based on SEQRES records: (download)

>d4b0ma_ b.167.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
lwpclsslqltkygididkypdliksgteqcvdllaiphsdvqfyfnqqklslivppqal
lprfdgimpmqlwdd

Sequence, based on observed residues (ATOM records): (download)

>d4b0ma_ b.167.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
lwpclsslqltkygididkypdlieqcvdllaiphsdvqfyfnqqklslivppqallprf
dgimpmqlwdd

SCOPe Domain Coordinates for d4b0ma_:

Click to download the PDB-style file with coordinates for d4b0ma_.
(The format of our PDB-style files is described here.)

Timeline for d4b0ma_: