Lineage for d4awjl_ (4awj L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526324Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 1526325Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1526389Protein automated matches [193392] (1 species)
    not a true protein
  7. 1526390Species Human (Homo sapiens) [TaxId:9606] [193393] (7 PDB entries)
  8. 1526398Domain d4awjl_: 4awj L: [201539]
    Other proteins in same PDB: d4awja_, d4awjb_, d4awjd_, d4awje_, d4awjg_, d4awjh_, d4awjj_, d4awjk_
    automated match to d4awjf_
    complexed with act, acy, gol, v6f

Details for d4awjl_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (L:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d4awjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4awjl_ b.3.3.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqer

SCOPe Domain Coordinates for d4awjl_:

Click to download the PDB-style file with coordinates for d4awjl_.
(The format of our PDB-style files is described here.)

Timeline for d4awjl_: