Lineage for d4awjh_ (4awj H:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647482Protein Elongin C [54699] (3 species)
  7. 1647485Species Human (Homo sapiens) [TaxId:9606] [54700] (19 PDB entries)
  8. 1647502Domain d4awjh_: 4awj H: [201535]
    Other proteins in same PDB: d4awja_, d4awjc_, d4awjd_, d4awjf_, d4awjg_, d4awji_, d4awjj_, d4awjl_
    automated match to d2c9wc_
    complexed with act, acy, gol, v6f

Details for d4awjh_

PDB Entry: 4awj (more details), 2.5 Å

PDB Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
PDB Compounds: (H:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4awjh_:

Sequence, based on SEQRES records: (download)

>d4awjh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4awjh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgnevnfreipshvlskvcmyftykvrytn
ssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4awjh_:

Click to download the PDB-style file with coordinates for d4awjh_.
(The format of our PDB-style files is described here.)

Timeline for d4awjh_: