Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [226343] (2 PDB entries) |
Domain d3zxwg1: 3zxw G:12-150 [201388] Other proteins in same PDB: d3zxwa2, d3zxwb_, d3zxwc2, d3zxwd_, d3zxwe2, d3zxwf_, d3zxwg2, d3zxwh_ automated match to d1wdda2 complexed with cap, gol, mg |
PDB Entry: 3zxw (more details), 2.1 Å
SCOPe Domain Sequences for d3zxwg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zxwg1 d.58.9.0 (G:12-150) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} gyqagvkdyrltyytpdytpkdtdilaafrvtpqpgvpfeeaaaavaaesstgtwttvwt dlltdldrykgccydieplpgednqfiayiaypldlfeegsvtnmltsivgnvfgfkalk alrledlripvaylktfqg
Timeline for d3zxwg1: